PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016505442.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 666aa    MW: 76026.3 Da    PI: 9.8617
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016505442.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.41.2e-131794998
                    HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                      +k+g l +p  f+ ++ +g    ++   +  + g++W +k+  ++++    +++GW eF+++++L+ gD++vF+++g++ef  +v++f 
  XP_016505442.1 17 PGFKNG-LKIPVGFL-KYlKGH--DNV-HAILRRGGKKWVMKV--NGRR----MEDGWTEFAEEHDLQLGDMLVFRHEGNMEF--NVSIFG 94
                    556666.9*******.664433..233.3456679********..8887....89***********************99999..999986 PP

2B348.91.2e-15158243697
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     ++++ l++  l++p++fa ++ +++++  t++++d + rsW+  l    +++ +++++GW eF+ ++ LkegD v+F+ ++ +++++ +k++
  XP_016505442.1 158 IKPYCLTKYFLRIPRQFALDNRLNNRK-CTIIMRD-ELRSWTCSL--HTNGN-TYIGRGWHEFCTDKCLKEGDRVMFEIVS-NGETPIFKFH 243
                     6788889999***********999765.5999999.78*******..66654.579**********************887.6666787776 PP

3B354.32.4e-17302386594
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     +++++ l+++ + +p++fa ++ +++++   +++   + rsW++ l    +s+ +++++GW+eF+ ++ LkegD v+F+ +++ ++++v+
  XP_016505442.1 302 TIRPYCLSKHFVAVPRQFALKNRLNNRKC--MIIIRNERRSWTFSL--YTSSNNTYFGRGWREFCIEKCLKEGDRVMFEIISN-GETPVF 386
                     567899999*************9997665..66677799*******..999999*************************9985.443444 PP

4B341.32.8e-13438506576
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--T CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLke 76 
                     ++++++ k++ l+lp  f++++g+ + ++ +++l +e+ rsW+v+l   + + ++ +++GW+eFv+ang+++
  XP_016505442.1 438 TIKPYTIKHHVLYLPLAFVKSNGLMN-RHCEMILVNEKRRSWSVQL--GQMGHHFGIKRGWREFVRANGVQV 506
                     56899*****************8774.5669***************..888888***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.2E-21498IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.28E-206102IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.21896IPR003340B3 DNA binding domain
CDDcd100175.84E-151093No hitNo description
SMARTSM010198.6E-181196IPR003340B3 DNA binding domain
PfamPF023622.2E-101993IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.2E-17151242IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.9E-13153246IPR003340B3 DNA binding domain
PROSITE profilePS5086311.223153245IPR003340B3 DNA binding domain
SuperFamilySSF1019361.2E-16153242IPR015300DNA-binding pseudobarrel domain
CDDcd100174.18E-13158244No hitNo description
PfamPF023621.0E-13158244IPR003340B3 DNA binding domain
CDDcd100175.03E-14292388No hitNo description
Gene3DG3DSA:2.40.330.109.5E-21295389IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.02E-20296388IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.8E-15298392IPR003340B3 DNA binding domain
PROSITE profilePS5086312.887298391IPR003340B3 DNA binding domain
PfamPF023621.5E-15302387IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.3E-15427506IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.0E-13430506IPR015300DNA-binding pseudobarrel domain
CDDcd100175.78E-13433506No hitNo description
PROSITE profilePS508638.91434532IPR003340B3 DNA binding domain
SMARTSM010194.8E-9435524IPR003340B3 DNA binding domain
PfamPF023621.9E-11438506IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MKKVPPKKSH FFKPILPGFK NGLKIPVGFL KYLKGHDNVH AILRRGGKKW VMKVNGRRME  60
DGWTEFAEEH DLQLGDMLVF RHEGNMEFNV SIFGSSCCER EYAAYMQEDE DEEEETPKKF  120
DLEEKVKANI RTSGKAFPNA EAANKGMHLS PSHLICTIKP YCLTKYFLRI PRQFALDNRL  180
NNRKCTIIMR DELRSWTCSL HTNGNTYIGR GWHEFCTDKC LKEGDRVMFE IVSNGETPIF  240
KFHDLRGNPS HHPEVKKNNF DAKRISDEEK PKANIKASDK AFPNVEAAEK DKHLTHSHFI  300
CTIRPYCLSK HFVAVPRQFA LKNRLNNRKC MIIIRNERRS WTFSLYTSSN NTYFGRGWRE  360
FCIEKCLKEG DRVMFEIISN GETPVFVFQD LRGSPSLHPE VKKNYLDAKR IKTMDATSPK  420
VQVPASTSAD ANPHFISTIK PYTIKHHVLY LPLAFVKSNG LMNRHCEMIL VNEKRRSWSV  480
QLGQMGHHFG IKRGWREFVR ANGVQVYILV RMPRITPSEA IDKIQKLLVM GKETGTEASE  540
YNKILSPLTG FSKRRLRLAG TVVVNGEGQK LVSQKTQAAA PLVAPVVDQQ NGRNDNGNFS  600
QSDNYLTHLV ELDSRLPKND SGMNKVLSEC GVSSSNVSTM VQPQLNAHVD ENPQKSMANK  660
DPVALA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016505442.10.0PREDICTED: putative B3 domain-containing protein REM15
TrEMBLM1AKH21e-162M1AKH2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000246731e-162(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.13e-60B3 family protein